missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Beskrivning
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WARS2. Source: E.coli Amino Acid Sequence: MELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPA The WARS2 Recombinant Protein Antigen is derived from E. coli. The WARS2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifikationer
Specifikationer
| Gen-ID (Entrez) | 10352 |
| Reningsmetod | >80% by SDS-PAGE and Coomassie blue staining |
| Vanligt namn | WARS2 Recombinant Protein Antigen |
| Innehåll och lagring | Store at −20°C. Avoid freeze-thaw cycles |
| Formulering | PBS and 1M Urea, pH 7.4 |
| För användning med (applikation) | Blocking/Neutralizing, Control |
| Gene Alias | (Mt)TrpRS, EC 6.1.1, EC 6.1.1.2, TrpRStryptophan-tRNA ligase, tryptophan tRNA ligase 2, mitochondrial, Tryptophan--tRNA ligase, tryptophanyl tRNA synthetase 2, mitochondrial, tryptophanyl-tRNA synthetase, mitochondrial |
| Gensymbol | WARS2 |
| Etiketttyp | Unlabeled |
| Produkttyp | Recombinant Protein Antigen |
| Visa mer |
For research use only.
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?