missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
WDR68 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-92589
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
WDR68 Polyclonal specifically detects WDR68 in Human, Drosophila samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifikationer
| WDR68 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P61962 | |
| DCAF7 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC | |
| Affinity Purified | |
| RUO | |
| 10238 | |
| Human, Drosophila | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DDB1 and CUL4 associated factor 7, DDB1- and CUL4-associated factor 7, HAN11AN11, human anthocyanin, seven-WD-repeat protein of the AN11 family-1, SWAN-1, WD repeat domain 68, WD repeat-containing protein 68, WD repeat-containing protein An11 homolog, WDR68, WD-repeat protein | |
| Rabbit | |
| 39 kDa | |
| 0.1 mL | |
| Primary | |
| Specificity of human WDR68 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido