missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Novus Biologicals™ wdyhv1 Recombinant Protein Antigen
Handla allt Bio Techne Produkter
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Descripción
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human wdyhv1. Source: E.coli Amino Acid Sequence: RPGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADS The wdyhv1 Recombinant Protein Antigen is derived from E. coli. The wdyhv1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Especificaciones
Especificaciones
| Gen-ID (Entrez) | 55093 |
| Reningsmetod | >80% by SDS-PAGE and Coomassie blue staining |
| Vanligt namn | wdyhv1 Recombinant Protein Antigen |
| Innehåll och lagring | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| För användning med (applikation) | Blocking/Neutralizing, Control |
| Gene Alias | C8orf32, chromosome 8 open reading frame 32, EC 3.5.1.-, FLJ10204, nt(Q)-amidase, NTAQ1, N-terminal Gln amidase, Protein NH2-terminal glutamine deamidase, protein N-terminal glutamine amidohydrolase, WDYHV motif containing 1, WDYHV motif-containing protei |
| Gensymbol | WDYHV1 |
| Etiketttyp | Unlabeled |
| Produkttyp | Recombinant Protein Antigen |
| Mostrar más |
For Research Use Only.
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido