missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Wee1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
5655.00 SEK
Specifikationer
| Antigen | Wee1 |
|---|---|
| Användningsområden | Western Blot, Immunocytochemistry, Immunofluorescence |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Värd art | Rabbit |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18200004
|
Novus Biologicals
NBP2-56925 |
100 μL |
5655.00 SEK
100µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
Wee1 Polyclonal specifically detects Wee1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifikationer
| Wee1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Stem Cell Markers | |
| DKFZp686I18166, EC 2.7.10.2, FLJ16446, WEE1 homolog (S. pombe), wee1+ (S. pombe) homolog, WEE1+ homolog, WEE1A, Wee1A kinase, WEE1hu, wee1-like protein kinase | |
| WEE1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7465 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel