missing translation for 'onlineSavingsMsg'
Learn More

WEE2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17636-25UL

Product Code. 18322935

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

WEE2 Polyclonal antibody specifically detects WEE2 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	WEE2
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	EC 2.7.10, EC 2.7.10.2, FLJ16107, WEE1 homolog 2 (S. pombe), WEE1B, Wee1B kinase, Wee1-like protein kinase 1B, wee1-like protein kinase 2
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: DIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPLSNVHELDTSSEKDKESPDQILRTPVSHPLKC
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	494551
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description