missing translation for 'onlineSavingsMsg'
Learn More

WFDC2 Recombinant Protein, Abnova

Human full-length ORF recombinant protein with GST-tag at N-terminal

Brand:  Abnova H00010406-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16185022

  • 3343.96 SEK / 10µg

Estimated Shipment: 07-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Encoded by WAP four-disulfide core domain 2
  • Molecular weight: 36.08kDa
  • Preparation method: in vitro wheat germ expression system
  • Purification: glutathione sepharose 4 fast flow
  • Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
  • pH=8.0 in elution buffer

Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Best when used within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH46106.1
Solution
10406
WFDC2 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
WFDC2
Human
Yes
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
36.08
8
Glutathione Sepharose 4 Fast Flow
10 ug
EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
HE4/MGC57529/WAP5/dJ461P17.6
WFDC2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates