missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
YAE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
5050.00 SEK
Specifikationer
| Antigen | C7orf36 |
|---|---|
| Utspädning | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Användningsområden | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18270606
|
Novus Biologicals
NBP1-81830 |
0.1 mL |
5050.00 SEK
0.10ml |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
YAE1 Polyclonal specifically detects YAE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| C7orf36 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 57002 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LKHLKSITPPSHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDCSYVECCRTQEHAHSENPSPT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C7orf36, chromosome 7 open reading frame 36, GK003, hypothetical protein LOC57002, Yae1 domain containing 1 | |
| YAE1D1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel