missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 15868783

Invitrogen™ Zfp566 Polyclonal Antibody
GREENER_CHOICE

Produktkod. 15868783
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
15868783 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 15868783 Leverantör Invitrogen™ Leverantörsnummer PA570376

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

This target displays homology in the following species: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%.

Zfp566 gene ontology annotations related to this gene include regulation of transcription, DNA-templated.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen Zfp566
Användningsområden Western Blot
Klassificering Polyclonal
Koncentration 0.5 mg/mL
Konjugera Unconjugated
Formulering PBS with 2% sucrose and 0.09% sodium azide
Gen Zfp566
Genaccessionsnr. 0
Gene Alias 2700043M03Rik; mszf4; RGD1563239; Zfp566; zinc finger protein 566
Gensymboler Zfp566
Värd art Rabbit
Immunogen synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI.
Reningsmetod Affinity chromatography
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 502316
Målarter Rat
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Produkttyp Antibody
Form Liquid
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.