missing translation for 'onlineSavingsMsg'
Learn More

ZNF552 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09925-25UL

Product Code. 18323214

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ZNF552 Polyclonal specifically detects ZNF552 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ZNF552
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	ZNF552 zinc finger protein 552
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of Human ZNF552 (NP_079038). Peptide sequence RSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQH
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	79818
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description