missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF552 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09925-25UL
This item is not returnable.
View return policy
Description
ZNF552 Polyclonal specifically detects ZNF552 in Human samples. It is validated for Western Blot.Specifications
ZNF552 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ZNF552 zinc finger protein 552 | |
The immunogen is a synthetic peptide directed towards the middle region of Human ZNF552 (NP_079038). Peptide sequence RSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQH | |
25 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
79818 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |