missing translation for 'onlineSavingsMsg'
Läs mer

Novus Biologicals™ ZNF76 Recombinant Protein Antigen

Produktkod. 18371390 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0,1 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18371390 0,1 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18371390 Leverantör Novus Biologicals™ Leverantörsnummer NBP185324PEP

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF76. The ZNF76 Recombinant Protein Antigen is derived from E. coli. The ZNF76 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-85324. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 7629
Art Human
Reningsmetod Chromatography
Renhet >80%
Koncentration 0.5mg/mL
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gensymbol ZNF76
Etiketttyp Unlabeled
Molekylvikt (g/mol) 25kDa
Produkttyp ZNF76
Kvantitet 0,1 ml
Regulatorisk status RUO
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85324. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen HCKPYTCSTCGKTYRQTSTLAMHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRI
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.