missing translation for 'onlineSavingsMsg'
Learn More

ZNF83 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10500-100UL

Product Code. 18323324

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ZNF83 Polyclonal specifically detects ZNF83 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ZNF83
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	FLJ11015, FLJ30097, FLJ90585, HPF1, MGC33853, Zinc finger protein 816BFLJ14876, zinc finger protein 83, zinc finger protein 83 (HPF1), Zinc finger protein HPF1, ZNF816B
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF83 (NP_060770). Peptide sequence MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	55769
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description