missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
ZNF879 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91424
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
ZNF879 Polyclonal specifically detects ZNF879 in Human samples. It is validated for Western Blot.
Specifikationer
| ZNF879 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ZNF879 | |
| Synthetic peptide directed towards the N terminal of human DKFZp686E2433. Peptide sequence: MKSGGTNAGGSARETRRLSGAQAQLRPAATGNVSELGVPLASCAVWSCAP | |
| Affinity purified | |
| RUO | |
| 345462 | |
| Human | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| zinc finger protein 879 | |
| Rabbit | |
| 77 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering