Sequence: LKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELE
C19orf58/MGC2594/PCIA1; cross-immune reaction antigen PCIA1; DET1- and DDB1-associated protein 1; PCIA-1; Placenta cross-immune reaction antigen 1
Cat # 16054487
100 uL
Cat # 16085897
100 ug
Cat # 16686944
100 µL
Cat # 15921365
100 µg
Cat # 16853954
150 µL
Cat # 16863954
20 µL
Cat # 15958664
100 µL
Cat # 16003237
100 ug
Cat # 15767731
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.