Sequence: PSPPESPQILAPTKPNFDIAWTSQPLDPSSDPSSLEDPRARPPKALLAERAHLQPREEPGALNSPATPTSNCQKSQPSSRPRVADLKKCFE
Connecdenn 3; DENN domain-containing protein 1C; DENN/MADD domain containing 1C; FAM31C/FLJ22757; family with sequence similarity 31, member C; Protein FAM31C
Cat # 16126510
100 uL
Cat # 15567072
100 µL
Cat # 17100964
100 µg
Cat # 15767981
100 µL
Cat # 16156510
100 uL
Cat # 15787941
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.