Sequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
Cancer/testis antigen 1.8; cancer/testis antigen family 1, member 8; CT1.8; MAGE-8 antigen; MAGE8/MGC2182; melanoma antigen family A, 8; melanoma antigen family A8; Melanoma-associated antigen 8
Cat # 16140945
100 µL
Cat # 16137561
50 µL
Cat # 15779990
100 µL
Cat # 16814024
150 µL
Cat # 16187760
100 uL
Cat # 16167370
100 uL
Cat # 16644015
100 µL
Cat # 15505272
100 µL
Cat # 16824024
20 µL
Cat # 16147561
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.