Sequence: GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR
-; [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial; Pyruvate dehydrogenase kinase isoform 3; pyruvate dehydrogenase kinase, isoenzyme 3; pyruvate dehydrogenase, lipoamide, kinase isozyme 3, mitochondrial
Cat # 16172575
100 µg
Cat # 16089117
400 uL
Cat # 15785847
0.1 ml
Cat # 16529741
100 µL
Cat # 17117158
100 µL
Cat # 13462127
100 µL
Cat # 17169153
100 µL
Cat # 15939914
100 µL
Cat # 16152575
100 µg
Cat # 16829793
150 µL
Cat # 15972855
100 µL
Cat # 16839793
20 µL
Cat # 13280909
400 µL
Cat # 16142575
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.