accessibility menu, dialog, popup

UserName

Filtrerade sökresultat

Produkter från vissa av våra leverantörer visas inte i filtrerade sökresultat. Vänligen Rensa alla filter för att se dessa produkter.

Begränsa resultat

Begränsa resultat

Kategori

Varumärken

  • (5)
  • (1)
  • (6)

För användning med (applikation)

  • (5)
  • (10)
  • (5)
  • (10)
  • (10)

Form

  • (5)

Rekombinant

  • (5)

Art

  • (5)

Kvantitet

  • (1)
  • (1)

Användningsområden

  • (1)
  • (1)
  • (1)

Klassificering

  • (1)

Konjugera

  • (1)

Kvalitet

  • (1)

Värd art

  • (1)

Sök resultat för "pH Paper and Buffers"

Visar endast närmaste matchningar. Utöka denna sökning Utöka denna sökning för fler resultat.
1 – 9 av 9 Resultat
1

PAPSS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Värd art Rabbit
Klassificering Polyclonal
Primär eller sekundär Primary
Antigen PAPSS2
Molekylvikt av antigen 70 kDa
Gene Alias 3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2
Gensymboler PAPSS2
Immunogen Synthetic peptides corresponding to PAPSS2(3'-phosphoadenosine 5'-phosphosulfate synthase 2) The peptide sequence was selected from the C terminal of PAPSS2. Peptide sequence PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN.
Regulatorisk status RUO
Isotyp IgG
Genaccessionsnr. O95340-2
Konjugera Unconjugated
Forskningsdisciplin Stem Cell Markers
Gen-ID (Entrez) 9060
2

Novus Biologicals™ Recombinant Human PAPSS2 GST (N-Term) Protein

Recombinant Protein

Gensymbol PAPSS2
Förvaringskrav Store at -80°C. Avoid freeze-thaw cycles.
Gene Alias 3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2
Molekylvikt (g/mol) 95.9 kDa
Formulering 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Forskningskategori Stem Cell Markers
För användning med (applikation) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein PAPSS2
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Gen-ID (Entrez) 9060
3

Novus Biologicals™ Recombinant Human PAPSS2 GST (N-Term) Protein

Recombinant Protein

Gensymbol PAPSS2
Förvaringskrav Store at -80°C. Avoid freeze-thaw cycles.
Gene Alias 3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2
Molekylvikt (g/mol) 36.74 kDa
Formulering 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Forskningskategori Stem Cell Markers
För användning med (applikation) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein PAPSS2
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Gen-ID (Entrez) 9060
4

Abnova™ Human ACPP Full-length ORF (NP_001090.2, 1 a.a. - 386 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Form Liquid
Vanligt namn ACPP
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Gensymbol ACPP
Namn ACPP (Human) Recombinant Protein (P01)
Uttryckssystem wheat germ expression system
Gene Alias ACP-3/ACP3/PAP
Reningsmetod Glutathione Sepharose 4 Fast Flow
Molekylvikt (g/mol) 71kDa
Regulatorisk status RUO
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
För användning med (applikation) Antibody Production,Protein Array,ELISA,Western Blot
Protein Tag GST
Gen-ID (Entrez) 55
Tillträdesnummer NP_001090.2
5

Abnova™ Human REG3A Full-length ORF (AAH36776, 1 a.a. - 175 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Form Liquid
Vanligt namn REG3A
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Gensymbol REG3A
Namn REG3A (Human) Recombinant Protein (P02)
Uttryckssystem wheat germ expression system
Gene Alias HIP/INGAP/PAP/PAP-H/PAP1/PBCGF/REG-III/REG3
Reningsmetod Glutathione Sepharose 4 Fast Flow
Immunogen MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Molekylvikt (g/mol) 44.77kDa
Regulatorisk status RUO
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
För användning med (applikation) Antibody Production,Protein Array,ELISA,Western Blot
Protein Tag GST
Gen-ID (Entrez) 5068
Tillträdesnummer AAH36776
7

EDTA dinatriumsaltdihydrat, Reag. Ph. EUR, 99-101 %,≤ 0,1 % NTA (HPLC), för komplexometri, Honeywell Fluka™

CAS: 6381-92-6 Molekylformel: C10H18N2Na2O10 Molekylvikt (g/mol): 372.24 MDL-nummer: MFCD00150037,MFCD00003541 InChI-nyckel: OVBJJZOQPCKUOR-UHFFFAOYSA-L Synonym: edta disodium salt,cal-ex decalcifier,buffer solution, ph 10.00,sodium di ethylenediamine tetraacetate dihydrate,ethylenediamine tetraacetic acid, disodium salt dihydrate,ethylenediamine tetraacetic acid, disodium salt, standard solution,sodium di ethylenediamine tetraacetate standard solution,ethylenedinitrilo tetraacetic acid disodium, dihydrate, reagent, acs PubChem CID: 44120005 LEDER: O.O.[Na+].[Na+].OC(=O)CN(CCN(CC(O)=O)CC([O-])=O)CC([O-])=O

Molekylformel C10H18N2Na2O10
PubChem CID 44120005
MDL-nummer MFCD00150037,MFCD00003541
CAS 6381-92-6
InChI-nyckel OVBJJZOQPCKUOR-UHFFFAOYSA-L
LEDER O.O.[Na+].[Na+].OC(=O)CN(CCN(CC(O)=O)CC([O-])=O)CC([O-])=O
Molekylvikt (g/mol) 372.24
Synonym edta disodium salt,cal-ex decalcifier,buffer solution, ph 10.00,sodium di ethylenediamine tetraacetate dihydrate,ethylenediamine tetraacetic acid, disodium salt dihydrate,ethylenediamine tetraacetic acid, disodium salt, standard solution,sodium di ethylenediamine tetraacetate standard solution,ethylenedinitrilo tetraacetic acid disodium, dihydrate, reagent, acs
8

Abnova™ Human MTMR12 Partial ORF (NP_061934, 648 a.a. - 747 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Form Liquid
Vanligt namn MTMR12
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Gensymbol MTMR12
Namn MTMR12 (Human) Recombinant Protein (Q01)
Uttryckssystem wheat germ expression system
Gene Alias 3-PAP/PIP3AP
Immunogen PEAQILGGGQVATLSKLLEMMEEVQSLQEKIDERHHSQQAPQAEAPCLLRNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDV
Molekylvikt (g/mol) 36.74kDa
Regulatorisk status RUO
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
För användning med (applikation) Antibody Production,ELISA,Protein Array,Western Blot
Protein Tag GST
Gen-ID (Entrez) 54545
Tillträdesnummer NP_061934
9

Abnova™ Human DDEF2 Partial ORF (NP_003878, 909 a.a. - 1006 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Form Liquid
Vanligt namn ASAP2
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Gensymbol ASAP2
Namn DDEF2 (Human) Recombinant Protein (Q01)
Uttryckssystem wheat germ expression system
Gene Alias AMAP2/CENTB3/DDEF2/FLJ42910/KIAA0400/PAG3/PAP/Pap-alpha/SHAG1
Immunogen RGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
Molekylvikt (g/mol) 36.52kDa
Regulatorisk status RUO
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
För användning med (applikation) Antibody Production,ELISA,Protein Array,Western Blot
Protein Tag GST
Gen-ID (Entrez) 8853
Tillträdesnummer NP_003878
Visar endast närmaste matchningar. Utöka denna sökning Utöka denna sökning för fler resultat.