AGA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-88865

Se fler versioner av denna produkt

Produktkod. 18262518

5455.00 SEK / 0.10ml

Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

AGA Polyclonal specifically detects AGA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifikationer

Antigen	AGA
Klassificering	Polyclonal
Utspädning	Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Genaccessionsnr.	P20933
Gensymboler	AGA
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:DELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFAQSMGFINEDLSTSASQALHSDWLARN
Kvantitet	0.1 mL
Forskningsdisciplin	Cell Cycle and Replication, Proteases & Other Enzymes
Gen-ID (Entrez)	175
Målarter	Human
Isotyp	IgG

Användningsområden	Immunohistochemistry, Immunohistochemistry (Paraffin)
Konjugera	Unconjugated
Formulering	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	AGU, aspartylglucosaminidase, aspartylglucosylamine deaspartylase, ASRG, EC 3.5.1, EC 3.5.1.26, GA, glycosylasparaginase, N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase, N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase
Värd art	Rabbit
Reningsmetod	Affinity Purified
Regulatorisk status	RUO
Primär eller sekundär	Primary
Testspecificitet	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Innehåll och lagring	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

AGA Antibody, Novus Biologicals™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer