Albumin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-38174

Se fler versioner av denna produkt

Produktkod. 18188397

4860.00 SEK / 0.10ml

Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Albumin Polyclonal specifically detects Albumin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifikationer

Antigen	Albumin
Klassificering	Polyclonal
Utspädning	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Genaccessionsnr.	P02768
Gensymboler	ALB
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: ADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF
Kvantitet	0.1 mL
Forskningsdisciplin	Apoptosis, Cancer, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers
Gen-ID (Entrez)	213
Målarter	Human
Isotyp	IgG

Användningsområden	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Konjugera	Unconjugated
Formulering	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	albumin, cell growth inhibiting protein 42, DKFZp779N1935, growth-inhibiting protein 20, PRO0883, PRO0903, PRO1341, serum albumin
Värd art	Rabbit
Reningsmetod	Affinity Purified
Regulatorisk status	RUO
Primär eller sekundär	Primary
Testspecificitet	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Innehåll och lagring	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

Albumin Antibody, Novus Biologicals™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer