missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Albumin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
4860.00 SEK
Specifikationer
| Antigen | Albumin |
|---|---|
| Användningsområden | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Värd art | Rabbit |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18188397
|
Novus Biologicals
NBP2-38174 |
0.1 mL |
4860.00 SEK
0.10ml |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
Albumin Polyclonal specifically detects Albumin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifikationer
| Albumin | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| albumin, cell growth inhibiting protein 42, DKFZp779N1935, growth-inhibiting protein 20, PRO0883, PRO0903, PRO1341, serum albumin | |
| ALB | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P02768 | |
| 213 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel