missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
ALDH1L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-81935
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
ALDH1L2 Polyclonal specifically detects ALDH1L2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| ALDH1L2 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q3SY69 | |
| ALDH1L2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| aldehyde dehydrogenase 1 family, member L2, aldehyde dehydrogenase family 1 member L2, DKFZp686A16126, DKFZp686M064, EC 1.5.1.6, FLJ36769, FLJ38508, MGC119536, MGC119537,10-formyltetrahydrofolate dehydrogenase ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, mtFDHDKFZp686P14145, probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 160428 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction