missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ AR (Human) Recombinant Protein

Human AR partial ORF ( NP_000035, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000367-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161761

  • 4055.00 SEK / 10µg
Estimated Shipment: 21-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: SKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGL
Specifications

Specifications

NP_000035
androgen receptor
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AR
GST
367
Wheat germ expression system
10 μg
AIS, DHTR, HUMARA, KD, NR3C4, SBMA, SMAX1, TFM
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers