missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ATP5G1 (Human) Recombinant Protein
Human ATP5G1 full-length ORF ( AAH04963, 18 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00000516-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Specifications
| AAH04963 | |
| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ATP5G1 | |
| GST |
| 516 | |
| Wheat germ expression system | |
| 10 μg | |
| ATP5A, ATP5G | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |