missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BSX Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10602-100UL
3568.00 SEK valid until 2025-03-28
Use promo code "25306" to get your promotional price.
This item is not returnable.
View return policy
Description
BSX Polyclonal specifically detects BSX in Mouse samples. It is validated for Western Blot.
Specifications
BSX | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
brain-specific homeobox, brain-specific homeobox protein homolog, BSX1 | |
The immunogen is a synthetic peptide directed towards the middle region of MOUSE BSX (NP_839976). Peptide sequence RRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVL | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
390259 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
BSX Rabbit anti-Mouse, Polyclonal, Novus Biologicals™ > 100 μg; Unconjugated
Spot an opportunity for improvement?Share a Content Correction