missing translation for 'onlineSavingsMsg'
Learn More

BSX Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10602-100UL

Product Code. 18321604

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

BSX Polyclonal specifically detects BSX in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	BSX
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	brain-specific homeobox, brain-specific homeobox protein homolog, BSX1
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of MOUSE BSX (NP_839976). Peptide sequence RRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVL
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Mouse
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	390259
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description