missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
BSX Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10602-25UL
Denna artikel kan inte returneras.
Se returpolicy
Description
BSX Polyclonal specifically detects BSX in Mouse samples. It is validated for Western Blot.
Specifications
| BSX | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| brain-specific homeobox, brain-specific homeobox protein homolog, BSX1 | |
| The immunogen is a synthetic peptide directed towards the middle region of MOUSE BSX (NP_839976). Peptide sequence RRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVL | |
| 25 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 390259 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction