missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
C1orf53 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
5960.00 SEK
Specifikationer
| Antigen | C1orf53 |
|---|---|
| Användningsområden | Immunocytochemistry, Immunofluorescence |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Värd art | Rabbit |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18281993
|
Novus Biologicals
NBP2-55834 |
100 μL |
5960.00 SEK
100µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
C1orf53 Polyclonal specifically detects C1orf53 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifikationer
| C1orf53 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Chromosome 1 Open Reading Frame 53 | |
| C1orf53 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 388722 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel