missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-33660-25ul
2924.00 SEK valid until 2025-12-16
BÄSTA PRIS på kampanj! Använd kampanjkod: "24090" för att få ditt kampanjpris.
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
Chymase/CMA1/Mast Cell Chymase Polyclonal specifically detects Chymase/CMA1/Mast Cell Chymase in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifikationer
| Chymase/CMA1/Mast Cell Chymase | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| P23946 | |
| CMA1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS | |
| 25 μL | |
| Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers | |
| 1215 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering