missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ CKM Recombinant Protein Product Code.: 16133241
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ CKM Recombinant Protein

Abnova™ CKM Recombinant Protein

Product Code. 16133241
10 μg, 10µg
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16133241

Brand: Abnova™ H00001158P01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Human CKM full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.

  • Theoretical MW (kDa): 67.65
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number AAH07462
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 1158
Molecular Weight (g/mol) 67.7
Name CKM (Human) Recombinant Protein (P01)
pH Range 8
Preparation Method In vitro wheat germ expression system
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Source Wheat Germ (in vitro)
Immunogen MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias CKMM/M-CK
Common Name CKM
Gene Symbol CKM
Cross Reactivity Human
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Form Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ CKM Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.