missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ EIF4EBP1 (Human) Recombinant Protein

Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00001978-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16114441

Estimated Shipment: 11-07-2022
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Specifications

Accession Number	AAH04459
Name	eukaryotic translation initiation factor 4E binding protein 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	EIF4EBP1
Protein Tag	GST

Gene ID (Entrez)	1978
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
Host Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description