missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ EIF4EBP1 (Human) Recombinant Protein

Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

4515.00 SEK - 6845.00 SEK

Accession Number	AAH04459
Gene ID (Entrez)	1978
Name	eukaryotic translation initiation factor 4E binding protein 1
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16104441 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00001978-P01.10UG	10 μg	4515.00 SEK 10µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16114441 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00001978-P01.25UG	25 μg	6845.00 SEK 25µg View alternative products Save Up to »	Estimated Shipment: 31-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Specifications

Accession Number	AAH04459
Name	eukaryotic translation initiation factor 4E binding protein 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	1978
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	EIF4EBP1
Protein Tag	GST

Description