Emx1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand: Novus Biologicals NBP1-86500

Se fler versioner av denna produkt

Produktkod. 18259806

5050.00 SEK / 0.10ml

Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Emx1 Polyclonal specifically detects Emx1 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifikationer

Antigen	Emx1
Klassificering	Polyclonal
Konjugera	Unconjugated
Formulering	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gensymboler	EMX1
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
Kvantitet	0.1 mL
Primär eller sekundär	Primary
Testspecificitet	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Innehåll och lagring	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Användningsområden	Immunohistochemistry, Immunohistochemistry (Paraffin)
Koncentration	0.1mg/mL
Utspädning	Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	empty spiracles homeobox 1, empty spiracles-like protein 1
Värd art	Rabbit
Reningsmetod	Affinity Purified
Regulatorisk status	RUO
Gen-ID (Entrez)	2016
Målarter	Human, Mouse
Isotyp	IgG

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

Emx1 Antibody, Novus Biologicals™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer