missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FLT3 (Human) Recombinant Protein
Human FLT3 partial ORF ( NP_004110, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00002322-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP
Specifications
| NP_004110 | |
| fms-related tyrosine kinase 3 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLT3 | |
| GST |
| 2322 | |
| Wheat germ expression system | |
| 25 μg | |
| CD135, FLK2, STK1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |