missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FLT3 (Human) Recombinant Protein

Human FLT3 partial ORF ( NP_004110, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002322-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16118254

  • 6150.00 SEK / 25µg
Estimated Shipment: 14-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP
Specifications

Specifications

NP_004110
fms-related tyrosine kinase 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLT3
GST
2322
Wheat germ expression system
25 μg
CD135, FLK2, STK1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers