missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
FXR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-89546-25ul
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
FXR1 Polyclonal specifically detects FXR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifikationer
| FXR1 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/mL, Simple Western 1:100, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| fragile X mental retardation syndrome-related protein 1, fragile X mental retardation, autosomal homolog 1, FXR1P, hFXR1p | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of FXR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FXR1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL | |
| 25 μL | |
| Apoptosis, Immune System Diseases, Immunology | |
| 8087 | |
| Human, Mouse, Rat | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering