missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
GLT8D2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17856-25UL
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
GLT8D2 Polyclonal antibody specifically detects GLT8D2 in Human samples. It is validated for Immunofluorescence
Specifikationer
| GLT8D2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| EC 2.4.1, EC 2.4.1.-, FLJ31494, GALA4A, glycosyltransferase 8 domain containing 2, glycosyltransferase 8 domain-containing protein 2, gycosyltransferase | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 83468 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering