missing translation for 'onlineSavingsMsg'
Learn More

GLT8D2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17856-100UL

Product Code. 18324085

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

GLT8D2 Polyclonal antibody specifically detects GLT8D2 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	GLT8D2
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	EC 2.4.1, EC 2.4.1.-, FLJ31494, GALA4A, glycosyltransferase 8 domain containing 2, glycosyltransferase 8 domain-containing protein 2, gycosyltransferase
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	83468
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description