missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ABCF2 Partial ORF (AAH01661, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010061-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16181766

  • 3343.96 SEK / 10µg

Estimated Shipment: 15-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]

Sequence: MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS
Specifications

Specifications

AAH01661
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS
RUO
ABCF2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10061
ABCF2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ABC28/DKFZp586K1823/EST133090/HUSSY-18/HUSSY18/M-ABC1
ABCF2
Yes
Videos
SDS
Documents
Certificates