missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ADAMTSL1 Partial ORF (NP_644669.1, 192 a.a. - 291 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00092949-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16181247

  • 5030.41 SEK / 25µg

Estimated Shipment: 11-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq]

Sequence: YKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLNSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQF
Specifications

Specifications

NP_644669.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
YKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLNSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQF
RUO
ADAMTSL1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
92949
ADAMTSL1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ADAMTSR1/C9orf94/DKFZp686L03130/FLJ35283/FLJ41032/FLJ46891/MGC118803/MGC118805/MGC40193/PUNCTIN
ADAMTSL1
Yes
Videos
SDS
Documents
Certificates