Learn More
Abnova™ Human AKAP10 Partial ORF (NP_009133, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Description
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction. [provided by RefSeq]
Specifications
Specifications
Accession Number | NP_009133 |
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 11216 |
Molecular Weight (g/mol) | 36.74kDa |
Name | AKAP10 (Human) Recombinant Protein (Q01) |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quantity | 10 μg |
Immunogen | MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.