missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ALOX5AP Full-length ORF (AAH18538, 1 a.a. - 161 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000241-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131501

  • 3343.96 SEK / 10µg

Estimated Shipment: 15-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. [provided by RefSeq]

Sequence: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Specifications

Specifications

AAH18538
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
43.45kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ALOX5AP
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
241
ALOX5AP (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLAP
ALOX5AP
Yes
Videos
SDS
Documents
Certificates