missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ANTXR2 Partial ORF (NP_477520.2, 241 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00118429-Q01.10ug
Dettagli aggiuntivi : Weight : 0.00010kg
Beschreibung
This gene encodes a receptor for anthrax toxin. The protein binds to collagen IV and laminin, suggesting that it may be involved in extracellular matrix adhesion. Mutations in this gene cause juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVSpezifikation
| NP_477520.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.44kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIV | |
| RUO | |
| ANTXR2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 118429 | |
| ANTXR2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CMG-2/CMG2/FLJ31074/ISH/JHF/MGC111533/MGC45856 | |
| ANTXR2 | |
| Recombinant | |
| wheat germ expression system |