missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human APPBP2 Partial ORF (NP_006371, 486 a.a. - 585 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010513-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182676

  • 5030.41 SEK / 25µg

Estimated Shipment: 16-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. This gene has been found to be highly expressed in breast cancer. Multiple polyadenylation sites have been found for this gene. [provided by RefSeq]

Sequence: NQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC
Specifications

Specifications

NP_006371
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC
RUO
APPBP2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10513
APPBP2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HS.84084/KIAA0228/PAT1
APPBP2
Yes
Videos
SDS
Documents
Certificates