Learn More
Abnova™ Human ARHGEF4 Partial ORF (NP_056135, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00050649-Q02.25ug
Additional Details : Weight : 0.02000kg
Description
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. This protein is similar to rat collybistin protein. Alternative splicing of this gene generates two transcript variants which encode different isoforms. Also there is possibility for the usage of multiple polyadenylation sites for this gene. [provided by RefSeq]
Sequence: MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPHRSPVSVDDLWLEKTQRKKLQKQAHVERRLHIGAVHKDGVKSpecifications
NP_056135 | |
Liquid | |
50649 | |
ARHGEF4 (Human) Recombinant Protein (Q02) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ASEF/ASEF1/GEF4/STM6 | |
ARHGEF4 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPHRSPVSVDDLWLEKTQRKKLQKQAHVERRLHIGAVHKDGVK | |
RUO | |
ARHGEF4 | |
Wheat Germ (in vitro) | |
GST |