missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human ARMCX3 Partial ORF (NP_057691, 278 a.a. - 379 a.a.) Recombinant Protein with GST-tag at N-terminal Product Code.: 16137126
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human ARMCX3 Partial ORF (NP_057691, 278 a.a. - 379 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human ARMCX3 Partial ORF (NP_057691, 278 a.a. - 379 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16137126
10 μg, 10µg
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16137126

Brand: Abnova™ H00051566Q01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Sequence: RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE

Specifications

Accession Number NP_057691
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 51566
Molecular Weight (g/mol) 36.96kDa
Name ARMCX3 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias ALEX3/DKFZp781N1954/KIAA0443/MGC12199/dJ545K15.2
Common Name ARMCX3
Gene Symbol ARMCX3
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human ARMCX3 Partial ORF (NP_057691, 278 a.a. - 379 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.