Learn More
Abnova™ Human ARMCX3 Partial ORF (NP_057691, 278 a.a. - 379 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00051566-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]
Sequence: RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQESpecifications
| NP_057691 | |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.96kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE | |
| RUO | |
| ARMCX3 | |
| Wheat Germ (in vitro) | |
| GST |
| wheat germ expression system | |
| Liquid | |
| 51566 | |
| ARMCX3 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ALEX3/DKFZp781N1954/KIAA0443/MGC12199/dJ545K15.2 | |
| ARMCX3 | |
| Yes |