missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATAD4 Full-length ORF (NP_077296.1, 1 a.a. - 103 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00079170-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16124133

Estimated Shipment: 29-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK

Specifications

Accession Number	NP_077296.1
For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight	38.1kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Regulatory Status	RUO
Common Name	ATAD4
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Expression System	wheat germ expression system
Format	Liquid
Gene ID (Entrez)	79170
Name	ATAD4 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	MGC11242
Gene Symbol	ATAD4
Recombinant	Yes

Description