missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATN1 Partial ORF (AAH51795, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001822-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134191

  • 3343.96 SEK / 10µg

Estimated Shipment: 11-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Dentatorubral pallidoluysian atrophy is a rare neurodegenerative disorder characterized by cerebellar ataxia, myoclonic epilepsy, choreoathetosis, and dementia. The disorder is related to the expansion of a trinucleotide repeat within this gene. The encoded protein includes a serine repeat and a region of alternating acidic and basic amino acids, as well as the variable glutamine repeat. Alternative splicing results in two transcripts variants that encode the same protein. [provided by RefSeq]

Sequence: MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVEEASTPKVNKQGRSEEISESESEETNAPKKTKTEQELPRPQSPSDLDSLDG
Specifications

Specifications

AAH51795
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVEEASTPKVNKQGRSEEISESESEETNAPKKTKTEQELPRPQSPSDLDSLDG
RUO
ATN1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1822
ATN1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B37/D12S755E/DRPLA/NOD
ATN1
Yes
Videos
SDS
Documents
Certificates