missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BATF Full-length ORF (NP_006390.1, 1 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010538-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135272

  • 5030.41 SEK / 25µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq]

Sequence: MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Specifications

Specifications

NP_006390.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
40.5kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
BATF
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10538
BATF (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B-ATF/BATF1/SFA-2/SFA2
BATF
Yes
Videos
SDS
Documents
Certificates