missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BCL7C Partial ORF (NP_004756, 86 a.a. - 164 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009274-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16130316

  • 5030.41 SEK / 25µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined. [provided by RefSeq]

Sequence: PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT
Specifications

Specifications

NP_004756
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.43kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT
RUO
BCL7C
Yes
wheat germ expression system
Liquid
9274
BCL7C (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BCL7C
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates