missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human C20orf42 Partial ORF (NP_060141.2, 180 a.a. - 269 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human C20orf42 Partial ORF (NP_060141.2, 180 a.a. - 269 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16118236
Price: 4515.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00055612-Q01.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16118236

4515.00 SEK / 10µg

Estimated Shipment: 23-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: PGLYSKTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLL

Specifications

Accession Number	NP_060141.2
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	35.64kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	PGLYSKTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLL
Regulatory Status	RUO
Common Name	FERMT1
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	55612
Name	C20orf42 (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	C20orf42/DTGCU2/FLJ20116/FLJ23423/KIND1/UNC112A/URP1
Gene Symbol	FERMT1
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Abnova™ Human C20orf42 Partial ORF (NP_060141.2, 180 a.a. - 269 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Special Offers