missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human C5 Partial ORF (NP_001726, 1550 a.a. - 1661 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000727-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182431

  • 5030.41 SEK / 25µg

Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is the fifth component of complement, which plays an important role in inflammatory and cell killing processes. This protein is comprised of alpha and beta polypeptide chains that are linked by a disulfide bridge. An activation peptide, C5a, which is an anaphylatoxin that possesses potent spasmogenic and chemotactic activity, is derived from the alpha polypeptide via cleavage with a convertase. The C5b macromolecular cleavage product can form a complex with the C6 complement component, and this complex is the basis for formation of the membrane attack complex, which includes additional complement components. Mutations in this gene cause complement component 5 deficiency, a disease where patients show a propensity for severe recurrent infections. Defects in this gene have also been linked to a susceptibility to liver fibrosis and to rheumatoid arthritis. [provided by RefSeq]

Sequence: QTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFL
Specifications

Specifications

NP_001726
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.06kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFL
RUO
C5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
727
C5 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CPAMD4/FLJ17816/FLJ17822/MGC142298
C5
Yes
Videos
SDS
Documents
Certificates