missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Ca1 Partial Orf (Aah27890.1, 12 A.A.-150 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Brand:  Abnova™ H00000759-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16023705

  • 6150.00 SEK / 25µg
Estimated Shipment: 08-08-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK

Specifications

Specifications

AAH27890.1
Liquid
759
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Car1
CA1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
CA1 (Human) Recombinant Protein (Q01)
12.5% SDS-PAGE Stained with Coomassie Blue
NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK
RUO
CA1
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers

For Research Use Only